PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400013709
Common NameLOC102590426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 335aa    MW: 37684.5 Da    PI: 7.0459
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400013709genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.6e-32191248259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s+fpr+YYrCt+++C+vkk+vers ed ++v++tYeg Hnh+
  PGSC0003DMP400013709 191 EDGYRWRKYGQKAVKNSPFPRNYYRCTTQKCNVKKRVERSYEDSSIVITTYEGIHNHH 248
                           8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-33175250IPR003657WRKY domain
SuperFamilySSF1182901.11E-28182250IPR003657WRKY domain
PROSITE profilePS5081130.848185250IPR003657WRKY domain
SMARTSM007742.3E-37190249IPR003657WRKY domain
PfamPF031068.7E-25191248IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MSDNTFYHDY MGIGGGINNT FPFFGENPSN YNDQPIIPNI QNPNHQQFVP SSYMTLTECL  60
HGSMDYNTLS NAFGMSCSSS SEVVRPHIDN QDSTRKSSVS ATIEPVLDLP LGDKTSIEIS  120
PTPNSSISST SNEAGGQEDS SKIKKHVQEK GVQQEGEDKS KKECKEKKKG EKKVKEPRFA  180
FMTKSEIDNL EDGYRWRKYG QKAVKNSPFP RNYYRCTTQK CNVKKRVERS YEDSSIVITT  240
YEGIHNHHCP ATLRGNSSFL SSSHFMPNFP PQLFSQMLNI PPTNQNLLIT SAAYDNNNNN  300
NNYYYQQQHQ GSEYSLFGGG TNNDASWIQK QEPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-251832511078Probable WRKY transcription factor 4
2lex_A8e-251832511078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-159HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350002.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM1AD030.0M1AD03_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000201020.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-44WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]